SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016852 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016852
Domain Number 1 Region: 231-408
Classification Level Classification E-value
Superfamily RNI-like 2.55e-20
Family 28-residue LRR 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016852   Gene: ENSOGAG00000032887   Transcript: ENSOGAT00000025039
Sequence length 418
Comment pep:novel scaffold:OtoGar3:GL873811.1:341343:345419:-1 gene:ENSOGAG00000032887 transcript:ENSOGAT00000025039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSLLDLAAQSLLSDEDSALRALRELPAGLFPTLSAAAFDGGHVKTVTAMVQAWPFPCLH
LGSLRDQSITQDLLEAVLDGLQCIPPATVGLSRSKLKVLDFTHDFVHSNWEECSETSPAP
FVITHMLEEPEPDQLTCSSREGPPWDCEPVEIHTDLFLGGLFGFFHLSGFPSYILQRVEK
SRGCLRLRCRALVVNRVPFCSLVEILAVLELEAIREVRLHYHSRCCFLSDLIQFFTQVGR
MHNLGNLIMSDIPWDFPTNCFSLLSPLGHLQKLHLIFGCLSGQLHKMLSGLQKPLETLVI
NGCRLTKSDISYLSQSIHATSLKELVLCSNNLSQTVPGPLEVLLGEVSGTLQHLNLRSCR
LKEAQLTALLPALCCCSHLHSLVFYDNVISTSGITHMLQHLARLKELRRVQYPVPAEC
Download sequence
Identical sequences H0XL62
ENSOGAP00000016852 ENSOGAP00000016852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]