SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016874 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016874
Domain Number 1 Region: 412-709
Classification Level Classification E-value
Superfamily RNI-like 6.75e-47
Family 28-residue LRR 0.00028
Further Details:      
 
Domain Number 2 Region: 13-105,134-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000296
Family Shikimate kinase (AroK) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016874   Gene: ENSOGAG00000030467   Transcript: ENSOGAT00000035110
Sequence length 709
Comment pep:novel scaffold:OtoGar3:GL873565.1:13909208:13929008:-1 gene:ENSOGAG00000030467 transcript:ENSOGAT00000035110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKIRDLFCPCPETQEEPRIVILYGVDGIGKSTLARQVQKAWEKGQIYQDHFQHIFYFSCR
ELAQSNVISLAELITKAQAAPSAPLEQVLSRPEQLLFILDGIDEPRWVLQEQSTEVCLHW
SQPQEVAALLGSLLGKTILPEASFLITTRTVDLQKLIPSLKQPRWVEVLGFSESGRKEYF
YNYFTDESQALRALFLVESNPAVWTMCLVPWLSWLVCTCLKQQMESGEDLTLTTTTATGL
CLHYLSQVIPAQCLRHQLRGICSLAAEGIWQGKSLFSLDDLRKHRLDKPIISAFLKMRIL
QKHPTSLTYSFIHLCFQEFFVAMSCALGDEEERSEHPNSIGGVRRLLDAYERHVLVRAPT
RCFLFGLLSEQVGREMESIFTCQRAPELKQELLQWAKWEAQEMRFPRQPGFLELFHCLYE
TQDEEFVTEVMGHFQGSSVYVQTDMELLVFTFCIKFCHHVESLQLHEGGQPRSTWRPARV
ILHWESRISVPNDDRCFCSQKVMQVPVTDACWQLLFSILKDTGNLKELDLSGNPLSCSAV
QSLSETLRCPCCHLETLRLRKMTVVSVTHNNLHSDFWLILPENDMKAVLTNLIKLGLANC
GLTAEGCKDLAFGLSTSQTLTELELSFNMVTDAGAKHLCQRLRQQSCRLQRLQLVSCGLT
FSCCQDLASMLSTSRSLKELDLQQNDLGDLGVRLLCEGLRHPACSLTLL
Download sequence
Identical sequences H0XL84
ENSOGAP00000016874 ENSOGAP00000016874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]