SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016943 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016943
Domain Number 1 Region: 112-211
Classification Level Classification E-value
Superfamily Snake toxin-like 9.9e-41
Family Extracellular domain of cell surface receptors 0.0000185
Further Details:      
 
Domain Number 2 Region: 216-297
Classification Level Classification E-value
Superfamily Snake toxin-like 7.04e-20
Family Extracellular domain of cell surface receptors 0.0001
Further Details:      
 
Domain Number 3 Region: 26-104
Classification Level Classification E-value
Superfamily Snake toxin-like 8.04e-17
Family Extracellular domain of cell surface receptors 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016943   Gene: ENSOGAG00000031748   Transcript: ENSOGAT00000029567
Sequence length 337
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:1095451:1113506:-1 gene:ENSOGAG00000031748 transcript:ENSOGAT00000029567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPLLSLLPPLLLLVQTCVPAFWGLRCKRCESSGYCWVDECPLGQDLCRTTVMRIWEGG
EELEVVERGCAHSEKTNRTMSYRTGSQIITLTESVCGSDLCNQPSLVRAPSFPQSRYLEC
ISCASSDMSCERGRDQSLQCRSPREQCLEVVTYRSLEAIESLKDEQHLRGCGSLPGCPGP
TGFHNNHTFHFLQCCNTTKCNSGPVLELPNLPLNGVRCYSCEGNSTHGCSSEEASLIDCR
GPMNQCLEATGTNGLGDPDYTVRGCATNSWCQRVHVADAFPMTHLNVSCCNGSGCNHPAR
DVQHRRGGASQPGPAHLSLTITLLVTARLWGGTLLWT
Download sequence
Identical sequences H0XLF3
ENSOGAP00000016943 ENSOGAP00000016943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]