SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016977 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016977
Domain Number 1 Region: 227-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-63
Family Eukaryotic proteases 0.000000101
Further Details:      
 
Domain Number 2 Region: 47-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-23
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 186-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000252
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016977   Gene: ENSOGAG00000010755   Transcript: ENSOGAT00000010757
Sequence length 486
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:1641732:1656747:1 gene:ENSOGAG00000010755 transcript:ENSOGAT00000010757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGPQWGNYLWRSPHSAGCPGKMWWLLLWGILQARPTQGSVLLAQRLPQQLTSPRYPEPY
LKGQESTVDIEAPEGFAVRLVFQDFDLEPSQDCERDSVTISASGMNLSQFCGQQDSPLGS
PPGQREFVSSGRSLQLTFRTHAVSEDKPIHHHKGFLALYQAVAVNCSQPTSWASVASEAI
NTPGDNSTKIQSHCQEPYYQVVEAGTLSCTTPRTWKDKQGSQEVLQCVPVCGRPVIPIAQ
NQTTLGSSKAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSVSLRRNLSVDV
FLGHTDIDEMLKLGNYPVRRVVMHPDYRQNESHNFNGDIALLELQHSVPLGPSILPVCLP
DNETFYRSGLLGYVSGFGVEMGWLTTELKYSRQPIAPREACEAWLRERQRPEVFSDNMFC
VGDKTQKHNACQGDSGSVYVVWDDHAHHWVATGIVSWGIGCGTGYGFYTKVLNYVDWIKG
VMDSKD
Download sequence
Identical sequences H0XLI7
ENSOGAP00000016977 ENSOGAP00000016977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]