SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017010 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017010
Domain Number 1 Region: 564-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-47
Family DBL homology domain (DH-domain) 0.00064
Further Details:      
 
Domain Number 2 Region: 794-903
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 69-148
Classification Level Classification E-value
Superfamily F-box domain 2.09e-18
Family F-box domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017010   Gene: ENSOGAG00000028027   Transcript: ENSOGAT00000025308
Sequence length 905
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:9234908:9313964:-1 gene:ENSOGAG00000028027 transcript:ENSOGAT00000025308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VESYHTRFSAWTPFSNASLNRQLFQERVALISHWFDLWTNKQRQEFLFTIFLRCSKSQLR
FVQDWFSERMQVARADFCAVLPRVLSLHIFSFLNPKDLCAAAQVSWFWKFLTEQDCLWMP
KCIKFGWFLPYTPTDNEFGAWKHHYIACVSTLDWLTPREAEAIYGTLNEPKTEDEELAER
QREKCLRRIIWGEIVLCKKELFKVRPPWVSGTCCSSLLKPKCQPRLAQTVRERVGLHEAL
EKQLVLASLEALPKQSNIFGRHSYPMLSKKNWCGVYKNDDGSSYAFQPHVILISSHIPAY
EMVVESVKPGVISVVYEHSGTTLESLLYLLEKALDGQKAQSMGIFSDGDSRDINLLQGYK
IGIKNLLRPEVRNFWEKLGSFVATEEEGGHVDIFVPLGASEAGMEVLSQLTQLTGTFFTA
PTGIATGSYQHILSDWLGPPWGRAPPSLYFTQPKLQTWSSLTDFLEDTLRSVRKQLRPLF
KELRESISGRVIGQFVFDTMSMAHILNNREIVQALADGLMELSTEDSQRNVTEDNSQDTK
SSLSKNDLNLEVLVKLERKLQMDSAEKRTSVVRELLQSERKYVQMLGIVRDVYVMPLKAA
LSSNRAILSAVNIQIIFSDVLQILSLNRWFLDNLRDRLQEWGPAHCVGDIVLKFGSQLNT
YTNFFNNYPVVLKTIQKCREMTPAFRAFLKRHDKTIVTQMLSLPELLLYPSRRFEEYISL
LYALRLHTPAEHVDRGDLTTAVNQIKNYKGYIDQMKQNISMKDQLLDVQRIIRGCPVLSE
AKRYLIRIQEVAQLHCCDEEISFSLRRYEHIRDLSLFLFNDALLISSRDTSLTPFERTSK
TTYQFIASMTLHRIFVEDIPDSKYVKNAFILQGPKHEWICATEAEDDKFLWLSVLQNAIK
SSMEK
Download sequence
Identical sequences H0XLM0
ENSOGAP00000017010 ENSOGAP00000017010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]