SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017011 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017011
Domain Number 1 Region: 467-584
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000785
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017011   Gene: ENSOGAG00000033472   Transcript: ENSOGAT00000031965
Sequence length 601
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:2881366:2883171:-1 gene:ENSOGAG00000033472 transcript:ENSOGAT00000031965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSSLLPFQLWCPRPFGTYSQNQPRAPSATLKPSACPEPGSGAEPDHGPVHSENTPPAL
ATEVPTSQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKV
KGHWGSDSSKAKRRRRCLEPTKAPPDPGGREGPLAPEEGPASVGEDLLSVAEMVALVEQR
AALALQSYPRPPTPAPVVFVSAEQGGPAKGLGSERRSGGGDCSRVAEAVAHFEAQRDNTP
TKGLRKEERPGPGPGEVRIAFRISNGRESRAPEGSLPNGAGGRPGCAYPGSPGPGARAKD
KITCDLYQLISPSRDALPSNVEFLLARADEASEGESPAPARPEDTPPAPPPPPARDCGAS
GFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQSRGPDGPPEP
PPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLV
KIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDV
SLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEG
R
Download sequence
Identical sequences H0XLM1
ENSOGAP00000017011 XP_003799568.1.62490 ENSOGAP00000017011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]