SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017120 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017120
Domain Number 1 Region: 146-171,200-397
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-60
Family Voltage-gated potassium channels 0.00041
Further Details:      
 
Domain Number 2 Region: 17-114
Classification Level Classification E-value
Superfamily POZ domain 2.28e-27
Family Tetramerization domain of potassium channels 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017120   Gene: ENSOGAG00000007394   Transcript: ENSOGAT00000007397
Sequence length 488
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:830765:832231:1 gene:ENSOGAG00000007394 transcript:ENSOGAT00000007397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPPALPAAEEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEY
FFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREE
ERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPA
SPSQDVLEAASNSTSGAPAGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNI
MNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQIL
GQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGY
GDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQH
LSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSTFPQTPFKTGNSTATCTTNNNPNSCVN
IKKIFTDV
Download sequence
Identical sequences H0XLY0
ENSOGAP00000017120 ENSOGAP00000017120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]