SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017156 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017156
Domain Number 1 Region: 71-206
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.84e-31
Family Nuclease 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017156   Gene: ENSOGAG00000030239   Transcript: ENSOGAT00000031694
Sequence length 223
Comment pep:known_by_projection scaffold:OtoGar3:GL873701.1:2230651:2233638:1 gene:ENSOGAG00000030239 transcript:ENSOGAT00000031694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLGWPAMAVAAVGLALALEALPWVLRRLRTGRRRPRREVLFFPSQVTCTEALLQAPGA
LAGSATACPCSLPHGESSLSRLLRALLAARASLELCLFAFSSPQLGRAVQLLHQRGVRVR
AITDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKKVLITGSLNWTTQAIQN
NRENVLIMEDEEYVRLFLEEFERIWEEFNPTKYTFFPQKKRSH
Download sequence
Identical sequences H0XM16
XP_003800768.1.62490 ENSOGAP00000017156 ENSOGAP00000017156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]