SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017189 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017189
Domain Number 1 Region: 6-57
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000798
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 100-216
Classification Level Classification E-value
Superfamily RNI-like 0.000000053
Family Rna1p (RanGAP1), N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017189   Gene: ENSOGAG00000030725   Transcript: ENSOGAT00000024306
Sequence length 378
Comment pep:novel scaffold:OtoGar3:GL873670.1:1819130:1821133:-1 gene:ENSOGAG00000030725 transcript:ENSOGAT00000024306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPRGQLPEEVLVFIFRHLPLRDRAAAARVCRAWAMAATCSTVWHDTNISSNTSCNRER
EDMLPPHMSACLNHIRNLRLEFEPSRKPSRQTATELLTELAGRASGLRSLRLECRGEKPL
FDAGRDVLDAVHAVCGSARELRHLDLRRLPFTLDDALVLKAASNCPELHSLFLDNSTLIG
SVGPGSVLKLLEACPHLRALGLHLASMSRASLEVLAAPDRAPLALLALRCACPEDARASP
LPNEAWAALRRRHPGLEVELELEPALPAEIVTCVLQPAVPVAALRLNLSSDTVGPVRFAA
RHYAATLRALEVRASASAELDAALEELAACCAGLREVHCFCVVRPSVRDAFCAHCPRLRA
YTLKLTREPHPWRPTLVA
Download sequence
Identical sequences H0XM49
ENSOGAP00000017189 ENSOGAP00000017189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]