SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017193 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017193
Domain Number 1 Region: 187-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.48e-50
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 28-136
Classification Level Classification E-value
Superfamily POZ domain 1.7e-23
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017193   Gene: ENSOGAG00000033887   Transcript: ENSOGAT00000031584
Sequence length 477
Comment pep:known_by_projection scaffold:OtoGar3:GL873546.1:327242:340381:-1 gene:ENSOGAG00000033887 transcript:ENSOGAT00000031584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMPGHAERQGAEPLSRGRCSAVRTRHVIINVGGCRVRLAWAALQRCPLARLERLRACR
GHDELLRVCDDYDVSRDEFFFDRSPCAFRAIAALLRAGKLRLLRGPCALAFRDELAYWGI
DEARLERCCLRRLRRREEEAAEARAGLEGRLAPGSPARTLGSRALGPGRRLERGRRCLRD
VVDNPHSGLAGKLFACVSVAFVAVTAVGLCLSTMPDIRAEEERGECSHKCRSLFVLETVC
VAWFSFEFLLRSLQAESKCAFLRTPLNIIDVVAILPFYVSLLVGLAAGGPGGTKLLERAG
LVLRLLRALRVLYVMRLARHSLGLRSLGLTVRRCARELGLLLLFLCVAMALFAPLVHLAE
RELGARRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSI
FHTFSRSYSELKEQQLRASSPEPALREDSTHSATGTEYSSQGPEGTDLAPTPSPRDA
Download sequence
Identical sequences H0XM53
ENSOGAP00000017193 ENSOGAP00000017193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]