SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017397 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017397
Domain Number 1 Region: 49-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-34
Family Voltage-gated potassium channels 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017397   Gene: ENSOGAG00000028161   Transcript: ENSOGAT00000031943
Sequence length 295
Comment pep:novel scaffold:OtoGar3:GL873554.1:16205550:16255621:1 gene:ENSOGAG00000028161 transcript:ENSOGAT00000031943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLLSRQSEPCGLWREFLPADTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRM
DRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYADALWWG
TITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEK
RRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTNQKLSFKERVRMASPRGQS
IKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVID
Download sequence
Identical sequences B4UT00
ENSOGAP00000017397 ENSOGAP00000017397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]