SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017507 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017507
Domain Number 1 Region: 77-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017507   Gene: ENSOGAG00000034540   Transcript: ENSOGAT00000026493
Sequence length 135
Comment pep:known_by_projection scaffold:OtoGar3:GL873592.1:5575485:5575892:1 gene:ENSOGAG00000034540 transcript:ENSOGAT00000026493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGTDAKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
LAICYISYLNHVLDV
Download sequence
Identical sequences H0XN16
XP_003793874.1.62490 XP_012663086.1.62490 ENSOGAP00000017507 ENSOGAP00000017507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]