SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017552 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017552
Domain Number 1 Region: 76-195
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-32
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 2 Region: 198-299
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-22
Family I set domains 0.0052
Further Details:      
 
Domain Number 3 Region: 294-388
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-21
Family I set domains 0.0091
Further Details:      
 
Domain Number 4 Region: 9-66
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000432
Family DBL homology domain (DH-domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017552   Gene: ENSOGAG00000030331   Transcript: ENSOGAT00000034658
Sequence length 795
Comment pep:novel scaffold:OtoGar3:GL873804.1:769244:788233:1 gene:ENSOGAG00000030331 transcript:ENSOGAT00000034658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGDPSQPPPLPLQHYLEQPVERVQRYQALLKELIRNKAHNRQNCALLEQAYAVVSALPQ
RAENKLHVSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNHLVIC
KPRRDSRTDTFSYVFRNMMKLSSVDLNDQVEGDDRAFEVWHEREDSVRKYLLQARTVIIK
NSWVKEICGIQQRLSLPVWRPPDFEEELADCTAELGETVKLACRVIGTPKPVVSWYKDGK
QVEVDPHHILIEDPDGSCALILDNLTGVDSGQYMCFAASAAGNASTLGKILVQVPPRFVK
KVRATPFVEGEDAQFTCTIEGTPYPQIRWYKDNALLTPGGKYRVVSEPRSGSLVLVIRAA
DKEDLGHYECELVNRLGSTRGGADLYMQSPALRAREQRHREQLMAAVEVTEQETKAPKKT
VIIEETITTVVKSPRGRRHSPSKSPSRSPSRRSASPPRLGLLASDLLYLPGGGQPRRPEV
ELGRKPTVPTLYVTEPEAHSPTLPGGTGSQRKWVEVEETIEVRVKKIGPQGVSPAREEVP
GGDPNSNNSNNKLLTQETRVQGPAVVCIGEPLVLHMDSGGSVDWATPDISSPDPSEEARA
PLKEEGREEEREEEEGAFVLEESQDTDGLQDRDPKILTHNGRVLTLADLEDYVPEEGETY
GCGSPTMPRAPSDPPCEVSVIQREIREPTVGQPILLNVGRALNPLGRWGLFRPESRARSP
DGVSFFVREPQVGPMGTAPHHTQSFCTRVQRSVDSGQGSFTTELSTQTVSFGTVGETVTL
HIRPDGDEAPGPSMG
Download sequence
Identical sequences H0XN61
ENSOGAP00000017552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]