SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017621 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017621
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000755
Family Snake venom toxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017621   Gene: ENSOGAG00000031540   Transcript: ENSOGAT00000033230
Sequence length 163
Comment pep:known_by_projection scaffold:OtoGar3:GL873810.1:48174:49895:1 gene:ENSOGAG00000031540 transcript:ENSOGAT00000033230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLAVLLVLVLPRVQTEDNITARQGQPAPAGVAVDAGSNRLTCHVCEKEDDFSCTNPQT
CAENQKYCVTAAIRMFPRFLLVSKQCSEHCGTAPDLPAKEFIMEEPTPFVYFVCCVTNTC
NNEGGVKLQFKEHTDRASEVSRGNARLATFLAFVSIVGGFGLP
Download sequence
Identical sequences H0XND0
ENSOGAP00000017621 ENSOGAP00000017621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]