SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017679 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017679
Domain Number 1 Region: 33-166
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-41
Family Regulator of G-protein signaling, RGS 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017679   Gene: ENSOGAG00000030571   Transcript: ENSOGAT00000034179
Sequence length 185
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:2815900:2845927:1 gene:ENSOGAG00000030571 transcript:ENSOGAT00000034179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNRAVSRLSRKRPPSDAHDSDGSSSSSRSSSRQSLKSTAKWATSLENLLEDPEGVKRFR
EFLKKEFSEENVLFWLACEDFKKTQDKKQMQEKAKEIYTTFLSSKASSQVNVEGQSRLNE
KILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDPPDAQTAAKRAS
RIYNT
Download sequence
Identical sequences H0XNI8
XP_003787164.1.62490 ENSOGAP00000017679 ENSOGAP00000017679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]