SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017711 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017711
Domain Number 1 Region: 396-618
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-50
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 622-755
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-26
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 143-230
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000269
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017711   Gene: ENSOGAG00000034639   Transcript: ENSOGAT00000030838
Sequence length 1078
Comment pep:known_by_projection scaffold:OtoGar3:GL873586.1:4023838:4039247:-1 gene:ENSOGAG00000034639 transcript:ENSOGAT00000030838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGLGVSGRRAASRPGPGLPSRDPEPYWAGGRSRHGEGQVCHHTDCQQLHRQGPLNLCE
ACDSKFHSAMHYDGHVRFDLPLQGSVLARNVSTRSCPPRTSPAVDLEEEEEVSVDSKGDR
KSTGLKLSKKKARRRYTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKG
IALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAKPGDEGKVEQGVKDSKSLSLPILRP
AGPGPPVLERVDPQSRWESLDILAPSRRRKNMSEFLGEASIPGQEPPTPSSCSLPSSGSG
STSSGGGDSWKNRAASRFSGFFSSGPSSSTFGREVDKMEQLEGKLHAYGLFGLPRLPRRL
CFDHDSWEEEEDDEDDEDEDSACLRVEDSWRELIDGHEKLTRRQCHQQEAVWELLHTEVA
YIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNILEIARLHRGLWGSVMVPVLEKAR
RTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKQP
QCQRLKLSDMLAKPHQRLTRYPLLLKSVLRKTDERRAKEAVVTMIGSVERFIHHVNACMR
QRQERQRLAAVVSRIDAYEVVEGSNDEVDKLLKEFLYLDLTAPISGASLEETRQLLLEGS
LKMKEGKDSKMDVYCFLFTDLLLVTKAVKKAEKTKVIRPPLLVDKIVCRELRDPGSFLLI
YLNEFHSAVGAYTFQASGQALCRGWVDAIYNAQNQLQQLRAQEHSSSQQHLQSLVEEEDE
QEEEEEEEEGEESSTSAASSPTILRRSSNSPDSQHCASDSSTETLAVVVVEPEEALSSPE
FDGGPFSSQSDETSLSTTASSITPTGELLPLGPVDGRSCSMDSAYGTLSPTSLQDFAGPA
PVAEPVTRPPELAQAPSPPPSPRLRRRTPVQLLPCLPHLLKSKSEASLLQLLSGAGTHGT
PPAPSRSLSELCLAALAPGARTGDCSQEAGPTWGCRGVSSPYSGSKPLEPENRATCLVEE
PAGSARRGCRELPSGSSPGVQPEPPPGVSAQHRKLTLAQLYRIRTTLLLNSTLTASEV
Download sequence
Identical sequences H0XNM0
ENSOGAP00000017711 ENSOGAP00000017711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]