SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017715 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017715
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-51
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-177
Classification Level Classification E-value
Superfamily POZ domain 1.73e-27
Family Tetramerization domain of potassium channels 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017715   Gene: ENSOGAG00000028070   Transcript: ENSOGAT00000030937
Sequence length 514
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:12327538:12333944:-1 gene:ENSOGAG00000028070 transcript:ENSOGAT00000030937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPSFFSQRQPLKGVFYRRAQRLRPQDQPRQGGQAED
RRRQIIINVGGSKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKMEEFAEMV
EREEEEDALDSEDRDSDGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFSFLRSP
LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSGMSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences H0XNM4
ENSOGAP00000017715 XP_003787748.1.62490 ENSOGAP00000017715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]