SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017718 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017718
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017718   Gene: ENSOGAG00000032665   Transcript: ENSOGAT00000027924
Sequence length 2234
Comment pep:known_by_projection scaffold:OtoGar3:GL873641.1:3140722:3161013:-1 gene:ENSOGAG00000032665 transcript:ENSOGAT00000027924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKNSKVSVVIPSDQVQKNIIVYSSGSQPGGNNQGAAVQGITFNVGHNLQKQT
ANVVPVQRTCNLVTPVSISRVYPSENKPWHQTTVSALATNQPVPLCLPATISAQNILELS
TSESESSVHGATTSSLIAVPLGPELHQHRSLHTCLNDQNSSENKNRQESPKLLKKTTSCS
TSIPPGSSAVATEVHHGNKSCLSIQDFRGDFQNTFVVSVSTTVCSQAPRSAGNSSPVSIS
KTASLTSATTVVAPSAPGVGRTTTPVSSLSANSLDSGWILSCSLPSSSVSASDLKNINSL
TRISSAGNTQTTWTTLQLAGNTIQPLSQTPSSAVTPVLNESGTNTTISNHNRHVAAGINL
NNSFPADGQPVEQVVVTLPSCPSLPLQPLIAQPQVKSQPPKNILPLNSAMQVIHMAQPVG
PTVNAAPANQNVIILQPPSTTPCPTVMRAEVPNQTVGQQIVIIQAANQNPLPLLSAPPPG
SVRLPVNGANAIIGSNNSAQNVSTPQTFGGKHLVHILPRPSSLSTSNSTPTFSVTMSNQQ
QPQTISLNGQLFALQPVMSSSGTTNQTPMQIIQPTTSEDPNTNVALNTFGALASLNQSIS
QMAGQSCVQLSISQPANPQTAANSQPPSANCVSLTTVAPLTTTDNSASLPSTYNLVTTPS
VNTVACLPPNVKSKRLNKKPGAKKHLAANKSACPLNPVRDVSKLDCPSAGSSAEPSCSDR
LLESLPVVLPSVPVSQANCVSVSASHSLDGLNSESVTPESVSKCKSAEESGSPSQESVTS
EHFAMAPAKSKDCTPNLQRETSQDKPTSLALSDAAKSCPSDSVLIPSPNDPHILVSQVSG
LSSTTSTTSTDCVSEVEIIAEPCRVEQDSSDTMQTTGLLKGQGLTTLLSDLAKEKDPQKS
SLSDQMSHPDFSSENSKIVDSSVNLQHKQELLLMGSDDRDPAQHHSCLPDQEVINGSLMP
SRQTDSPMSTSSGSSRSFSVASMLPETTREDVTSSTTTNTCDSCTFVEQTDIVALAARAI
FDQENLEKARVGLQADVREVTSKPSEASSLEGDPPFKSQTPKEKGTGQAEVTSDEFHSQD
SVEAAVDRPLEKPSCSLGIKTSNASLQASTSQPPSITSLSVNNLIHQNSISHPLVSCVGL
SQTSEQTTVPTTVNLTVSSSSYGNQPPGPPLMTEYSQEQLNTMTSNIPNSQIQEPLLKPS
HESRKDSAKRAVQDDLLLSSAKRQKHCQPAPLRLESMSLMSRTPDSISDQTQMMVGQIPP
NSSNSVVPVSNPAHGEGLARLFPSGNNFVAPALRQTEVQCSSQPSVAEQQQTQASQHLQA
LQQHVPVQGVSHLHSNHLYIKQQQQQQAGQLRERHHLYQLQHHVPHADSSVHSQPHNVHQ
QRTLQQEVQMQKKRNLVQATQASQLSLQPKHHATDQSRPKSGQPHPHHQQMQQQMQQHFG
SSQPEKSCENPSASRNHHSHPQNHLNQDIMHQQQDVGSRQQGSGVSSEHVSGHNPMQRLL
TSRGLEQQMVSQPSIVTRPSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMGISIQG
SRVSDQLEMRNYLDVPRNKSLAIHNMQGRVDHTVASDIRLSECQTFKPSGASQQPQSNFE
VQSSRNNEIGNPVPSLRSMQSQAFRVSQNTGPPPIDRQKRLTYPPVQGIPTGNAVPPRDS
ENACHQSFMQSLLAPHLGDQVIGSQRPLSEHQRNTQCGPSSAIEYNCPPAHESVHIRRES
ENQNRESCDMSLGAINTRNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKSNPMRITDSHGT
KGHMNPPVTTNMHGVARPALPHPSVSHGNADQGPPVRQANSSVPQRSRHPLQDSSGSKIR
QPERNRSGNQRHSNVFDPSLPHLPLSTSGSMILGRQQPAAEKRGSIVRFMPDSPQVPNDN
SGPDQHTLSQNFGFPFIPEGGMNPPINANTSFIPQVTQPSATRAPALIPVDPQNTLPSFY
PPYSPAHPTLSNDISIPYFSNQMFSNPSTEKVNSGSLNNRFGSILSPPRPVGFAQPSFPL
LTEMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPLLTIANSSASDSSKQSSNRPAH
NISHILGHDCSSAV
Download sequence
Identical sequences H0XNM7
ENSOGAP00000017718 XP_003797751.1.62490 ENSOGAP00000017718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]