SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017721 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017721
Domain Number 1 Region: 10-110
Classification Level Classification E-value
Superfamily Immunoglobulin 7e-32
Family V set domains (antibody variable domain-like) 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017721   Gene: ENSOGAG00000027925   Transcript: ENSOGAT00000029704
Sequence length 114
Comment pep:novel scaffold:OtoGar3:GL873666.1:431316:431657:1 gene:ENSOGAG00000027925 transcript:ENSOGAT00000029704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILLGSNGAIVMTQSPLSLPVTPGEPASISCRSSQNLLHTSGLNLMSWYLQKPGQSPQPL
IYFGLNRAPGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGLQLPLTVVQP
Download sequence
Identical sequences H0XNN0
ENSOGAP00000017721 ENSOGAP00000017721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]