SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017752 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017752
Domain Number 1 Region: 368-578
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 560-692
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 821-917
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-22
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 4 Region: 672-786
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.77e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017752   Gene: ENSOGAG00000032407   Transcript: ENSOGAT00000030857
Sequence length 959
Comment pep:known_by_projection scaffold:OtoGar3:GL873775.1:1039878:1088871:-1 gene:ENSOGAG00000032407 transcript:ENSOGAT00000030857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHRAPGGAGPSEPESPVATPPGASLPACANSDPGASEPGLPVRRGSGSALGGSLEPQF
SGPSDVSLGAAPGPRILPCGPNPQHHRALRFSYHLEGSQTRPGLYQGNRILVKSLSLDPG
QSLEPHPEGPQRLRSDPGPPTETPSQRSSPLKRVLGPKPQVPPKPSYLQMLRVSPLSEPI
PPPPSRPLPADPRVAKGLAPRVEANLSSAAVSSLIEKFEREPVIVTSDRPAPGPSPGTRE
PAMLPQLPPQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPPSHSLCPGPPALASVPVSLANPHRPNSQEVDSDLEEEDDDEEEKDQEIPVPPMER
QASVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHGIF
SNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVN
TWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSK
DAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLSA
KNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVSG
KQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPHSPNVDLGK
RAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNRVC
TDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHKAW
FVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYFS
PETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAASGATAEPAETPQTQDKI
Download sequence
Identical sequences H0XNR1
ENSOGAP00000017752 ENSOGAP00000017752 XP_003802773.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]