SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017767 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017767
Domain Number 1 Region: 16-88
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000193
Family Snake venom toxins 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017767   Gene: ENSOGAG00000024570   Transcript: ENSOGAT00000024949
Sequence length 111
Comment pep:novel scaffold:OtoGar3:GL873764.1:1790042:1791557:1 gene:ENSOGAG00000024570 transcript:ENSOGAT00000024949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTHLPWLLALLLLAWPAQAMRCHQCIATGNCLQPTSCQNHTRYCLTMWNSPPGHQTIVI
KSCAYTCPTLQESLPFSRASCCNTDLCNSTASHSTSWGLLALSIWCASLYT
Download sequence
Identical sequences H0XNS6
ENSOGAP00000017767 ENSOGAP00000017767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]