SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017777 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017777
Domain Number 1 Region: 261-373
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.92e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000891
Further Details:      
 
Domain Number 2 Region: 38-295
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.67e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017777   Gene: ENSOGAG00000025431   Transcript: ENSOGAT00000026852
Sequence length 373
Comment pep:novel scaffold:OtoGar3:GL873526.1:10075113:10076400:-1 gene:ENSOGAG00000025431 transcript:ENSOGAT00000026852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATVRCLVTVNQNNLTKSNIEIIYGHASFTSHPQPTVEVNGKKYTAPHILIATGGVPCIP
QDSQIPGASLRITSDGFFQLEEVPSHSVIVGAGYIAVEIAGILSALGSKTSLMIRNDKVL
RNFDSLIRTNCTEELENSGVEVFKFFQDKEVKKTSPGLEFIMVTSVPSRNPTVTMIPDVD
CLLWATGRDPNSRGLNLNKLGIQTDAKGHILVDEFQNTSVKDVYAVGDVCGRALLTPVAI
AAGQKLAHRLFECKEDSKFDYDNIPTVVFSHPPIGTVGLTEDEAIHKYGKENVKTYSTSF
TPMYHAVTKRKTKCVMKTVCANKEELVGIHMQGIGCDEMLQGFAVAVKMGTKAHFDRTVA
IHPTSSEELVTLC
Download sequence
Identical sequences H0XNT6
ENSOGAP00000017777 ENSOGAP00000017777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]