SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017805 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017805
Domain Number 1 Region: 60-81,168-245,278-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000561
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017805   Gene: ENSOGAG00000024574   Transcript: ENSOGAT00000032949
Sequence length 550
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:35831713:35859097:-1 gene:ENSOGAG00000024574 transcript:ENSOGAT00000032949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDSETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
LPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHNKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEG
SMLTISFGNWMELPGLKFKDWMSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRDNT
YITSVSRLYRDQDDDDSQVRDISTNHLQIEETKFIKRNWEIRGYQRVADGSHIPFCLFAE
NVALATGTLDSPAHLEIEGEGFPFVFHSMPEFGAAISKGKLRGKLDPVLIVGSGLTAADA
VLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTRSYSVNPNLSSDYT
SFPEHHVLSFKSDMKCILQSISGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHKSSQP
ITCKGNPVEIDTYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLTTRQKKKQHLF
VERGGGDGIA
Download sequence
Identical sequences H0XNW4
XP_012665334.1.62490 ENSOGAP00000017805 ENSOGAP00000017805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]