SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017961 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017961
Domain Number 1 Region: 157-352
Classification Level Classification E-value
Superfamily E set domains 3.69e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000276
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.69e-21
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017961   Gene: ENSOGAG00000032703   Transcript: ENSOGAT00000033532
Sequence length 419
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:11030558:11031817:-1 gene:ENSOGAG00000032703 transcript:ENSOGAT00000033532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYRIVNVDPKYPGYPPEHVITEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPRITPCVDNVHSFTA
AFLFSLETQTTIGYGYRCVTEECSVAVLTVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHGLEKPSRV
RGSCAADAKVRRRSFSAVAIVSSCENPEENAKSATDEHKEPPYQKALLTLNRISVESQM
Download sequence
Identical sequences H0XPC0
ENSOGAP00000017961 ENSOGAP00000017961 XP_003786222.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]