SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018030 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018030
Domain Number 1 Region: 375-478
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00053
Further Details:      
 
Domain Number 2 Region: 93-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000807
Family I set domains 0.057
Further Details:      
 
Domain Number 3 Region: 193-285
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000013
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 282-371
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000163
Family I set domains 0.0081
Further Details:      
 
Domain Number 5 Region: 11-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000903
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018030   Gene: ENSOGAG00000025828   Transcript: ENSOGAT00000028149
Sequence length 484
Comment pep:novel scaffold:OtoGar3:GL873610.1:2667181:2674646:-1 gene:ENSOGAG00000025828 transcript:ENSOGAT00000028149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADWLSIDMPHKAYEGDRVVIQCSGEKNKNIRRLMYYKDGSLISTYDSASSYTISHARASD
SGSYYCKADRKYFLFVDVTEETRSVWLTVQELFPAPRLTARPSQPTEGSSVTLSCDTSLP
SERSRTQLHYSFFRDGHTLKSGWSSAELWGLTLWTEDSGYYWCEAMTASHSVSRRSPRSH
IHVQRIRVSGVLMETQPPGGQAIEGETLVLICSVAEGTGDTTFSWHREDMESLGRKTQRS
QRAELGIPVVRESHAGGYYCTADNSYGPVQSGVVNVTVRIPVSHPVLRFRAPSTLALPGE
VVELSCEEQRASPILYRFYHENVTLGTTSAPSGGGASFFLSLTVKHSGNYSCDADNGQGP
QHSEAVALKVTETPPKVRLMNGPHPCEGRVEVEQEGRWGTVCDDGWDIKDVAVVCRELGC
GAPRHTPAAMLYPPAAEEAQPVLIQVALCNGTEAALAECEQVEPFDCGHVEDAGAVCEVS
PSTW
Download sequence
Identical sequences H0XPI9
ENSOGAP00000018030 ENSOGAP00000018030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]