SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018091 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000018091
Domain Number - Region: 70-138
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0018
Family Extracellular domain of cell surface receptors 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018091   Gene: ENSOGAG00000027034   Transcript: ENSOGAT00000027936
Sequence length 147
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:2546597:2552264:-1 gene:ENSOGAG00000027034 transcript:ENSOGAT00000027936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFMAGPAENRHLETLGLRRTLQALCMVLLTVLVMMSMVFGKIVPVNQKPSQFPKYLRCY
RCLLETKELGCLLGSDICLTPAGSSCITLHIKNSSGSDVMVSDCRSKEQMSDCSYTRASP
VFGFWIFSQCCFLDFCNDPQNRALHTP
Download sequence
Identical sequences H0XPQ0
XP_012660239.1.62490 ENSOGAP00000018091 ENSOGAP00000018091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]