SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018119 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000018119
Domain Number - Region: 57-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0599
Family LexA repressor, N-terminal DNA-binding domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018119   Gene: ENSOGAG00000033121   Transcript: ENSOGAT00000027964
Sequence length 125
Comment pep:novel scaffold:OtoGar3:GL873551.1:9410144:9410521:-1 gene:ENSOGAG00000033121 transcript:ENSOGAT00000027964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKDDKKKKDAGKSAKKHKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCK
EIPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPA
AGEDA
Download sequence
Identical sequences H0XPS8
ENSOGAP00000018119 ENSOGAP00000018119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]