SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018154 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018154
Domain Number 1 Region: 264-369
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 135-238
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 3 Region: 507-614
Classification Level Classification E-value
Superfamily SRCR-like 9.94e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000667
Further Details:      
 
Domain Number 4 Region: 6-110
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 391-503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 6 Region: 631-743
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-32
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018154   Gene: ENSOGAG00000033009   Transcript: ENSOGAT00000030198
Sequence length 1032
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:45876:71229:-1 gene:ENSOGAG00000033009 transcript:ENSOGAT00000030198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDSGLALRLVNASDHCGRVEVLYRGSWGTVCDDGWDTNDANVVCRQLCCGWARSAPGNA
CFGQGSGLIVLDDVACSGHESYLWSYRHNGWLLHNCGHSEDASVICSGSRARFDLEGDTA
ETEFSCFSPGSDSGLALRLVNGGDHCQGRVEVLYRGSWGTVCDDGWDTNDANVVCRQLGC
GWASSAPGNARFGQGSGPIVLDNVACSGHESNLWSCRHNGWLSHNCGHSEDAGVICAASQ
AQSTPMPDWWQTTPPVTAGSDSGLALRLVNGGDHCQGRVEILYRGSWGTVCDDGWDTNDA
NVVCRQLGCGRARSALGNAHFGQGSGPIVLDNVACSGHESYLWSCHHNGWLSHNCGHSED
AGVICSGNPVNSTENCWPYPITTTTARPSLNCGGFLFNDSGTFSSPSYPGYYPNNAKCVW
EIEVRSGYRINLGFKNLQLEPHSSCNFDYVEIFDGPSNRSNVLGKICNNTSEIFTSSSNR
MTIQFRSDISFQNIGFLAWYNSFPRDASLRLVNGNSSYDGCSGRVEIYHSGRWGTVCDDT
WTIQNAQVVCRQLQCGYAVSALGNAFFGSGSGPITLDDVVCSGTESTLWQCRNRGWFSHN
CGHHEDASVICSDLFFSSPAPVANITHPNTNYSCGGFLSQPSGTFSSPFYPGNYPNNARC
VWDIEVRNNYRVTVVFSNVQLEGGCSYDYIEVFDGPSHSFPLIARVCDGASGSFTSSSNF
MSIRFISDGSITRRGFLAEYYSSPSNDSTSLLCLPNHMQASVSRLYLQSLGYSARDLVIS
NWNGSYSCQPQITPSQVIFRIPYSGCGTIKQVENDTINYSNLLKAVVSSGIITRKKDLHI
HVSCKMLQDTWVNTMYITNDTVEVQEVQYGNFDVNISFYTSSSFLYPVTSSPYYVDLDQN
LYLQAEILHSDASLALFVDTCVASPHPSDFTSLTYDLLRSGCVKDETYRSYPQPSSRVAR
FKFNAFHFLNRFPSVYLQCRVVVCRAYDYSSRCYRGCVVRSKRDVGSYQEKVDVVLGPIQ
LQTHQVKKRSLG
Download sequence
Identical sequences H0XPW3
ENSOGAP00000018154 ENSOGAP00000018154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]