SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018207 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018207
Domain Number 1 Region: 94-213
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-32
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 2 Region: 216-317
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-22
Family I set domains 0.0052
Further Details:      
 
Domain Number 3 Region: 312-406
Classification Level Classification E-value
Superfamily Immunoglobulin 9e-21
Family I set domains 0.0091
Further Details:      
 
Domain Number 4 Region: 24-84
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000759
Family DBL homology domain (DH-domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018207   Gene: ENSOGAG00000030331   Transcript: ENSOGAT00000024462
Sequence length 816
Comment pep:novel scaffold:OtoGar3:GL873804.1:768940:786505:1 gene:ENSOGAG00000030331 transcript:ENSOGAT00000024462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSTAVQEFYKKYTEEALLAGDPSQPPPLPLQHYLEQPVERVQRYQALLKELIRNKAHNR
QNCALLEQAYAVVSALPQRAENKLHVSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMP
WKGHNRHVFLFRNHLVICKPRRDSRTDTFSYVFRNMMKLSSVDLNDQVEGDDRAFEVWHE
REDSVRKYLLQARTVIIKNSWVKEICGIQQRLSLPVWRPPDFEEELADCTAELGETVKLA
CRVIGTPKPVVSWYKDGKQVEVDPHHILIEDPDGSCALILDNLTGVDSGQYMCFAASAAG
NASTLGKILVQVPPRFVKKVRATPFVEGEDAQFTCTIEGTPYPQIRWYKDNALLTPGGKY
RVVSEPRSGSLVLVIRAADKEDLGHYECELVNRLGSTRGGADLYMQSPALRAREQRHREQ
LMAAVEVTEQETKAPKKTVIIEETITTVVKSPRGRRHSPSKSPSRSPSRRSASPPRLGLL
ASDLLYLPGGGQPRRPEVELGRKPTVPTLYVTEPEAHSPTLPGGTGSQRKWVEVEETIEV
RVKKIGPQGVSPAREEVPGGDPNSNNSNNKLLTQETRVQGPAVVCIGEPLVLHMDSGGSV
DWATPDISSPDPSEEARAPLKEEGREEEREEEEGAFVLEESQDTDGLQDRDPKILTHNGR
VLTLADLEDYVPEEGETYGCGSPTMPRAPSDPPCEVSVIQREIREPTVGQPILLNVGRAL
NPLGRWGLFRPESRGLSSQLPSSPQARSPDGVSFFVREPQVGPMGTAPHHTQSFCTRVQR
SVDSGQGSFTTELSTQTVSFGTVGETVTLHIRPDGD
Download sequence
Identical sequences H0XQ16
ENSOGAP00000018207 ENSOGAP00000018207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]