SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018229 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018229
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018229   Gene: ENSOGAG00000026608   Transcript: ENSOGAT00000031327
Sequence length 230
Comment pep:known_by_projection scaffold:OtoGar3:GL873565.1:11149010:11151464:1 gene:ENSOGAG00000026608 transcript:ENSOGAT00000031327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTRDRTENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPAAAAPGVPRSPAQDAEALASCYLSGFRECLLRLAAFAHDASPAAR
AQLFSALHGYLRPKLPRPDPVDPRSPAPRPPLDPAAPALGLALHQRPPVHQGPPSPRCAW
SSSLCSPRARDCGAPAPLTGLLPPPPPPHKQDGAPKAPPPPPTAFWRPWP
Download sequence
Identical sequences H0XQ38
XP_012661451.1.62490 ENSOGAP00000018229 ENSOGAP00000018229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]