SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018251 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018251
Domain Number 1 Region: 18-100
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000346
Family Extracellular domain of cell surface receptors 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018251   Gene: ENSOGAG00000031351   Transcript: ENSOGAT00000032845
Sequence length 101
Comment pep:known_by_projection scaffold:OtoGar3:GL873810.1:128089:129187:1 gene:ENSOGAG00000031351 transcript:ENSOGAT00000032845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPCWAVRLLLMAACSVGCGEAFRCYNCEQPTAIALCKNITQCKPEDTACKTTLVTVESE
YPFNHSPMVTRSCSSSCIATDPDGIGDAHPVYCCFRDLCNS
Download sequence
Identical sequences H0XQ60
XP_003803316.1.62490 ENSOGAP00000018251 ENSOGAP00000018251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]