SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018266 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018266
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Lysozyme-like 1.56e-45
Family C-type lysozyme 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018266   Gene: ENSOGAG00000028012   Transcript: ENSOGAT00000029798
Sequence length 142
Comment pep:known_by_projection scaffold:OtoGar3:GL873589.1:8882229:8884313:-1 gene:ENSOGAG00000028012 transcript:ENSOGAT00000029798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSFVPLLLVTILFPAIQTEELTKCQLYPMLKDLNDYRGITMPEWMCTLFHTSAFNTGAI
VQNDGSTEYGLFQISDKLWCKSKQTPHSRNICGISCDKLLDNDLTDDIKCAKKILDIKGI
DYWLAHKPLCTDRLEQWRCEEL
Download sequence
Identical sequences H0XQ75
XP_003793632.1.62490 ENSOGAP00000018266 ENSOGAP00000018266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]