SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018307 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018307
Domain Number 1 Region: 213-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.93e-50
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily POZ domain 2.38e-25
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018307   Gene: ENSOGAG00000025880   Transcript: ENSOGAT00000033173
Sequence length 528
Comment pep:known scaffold:OtoGar3:GL873542.1:7367427:7371918:-1 gene:ENSOGAG00000025880 transcript:ENSOGAT00000033173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLLVRGTHFENNWSKLIPPATIDALGNESPVPDSEVPNSGIPWRRSDEALSVNVGGVR
RRLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAGEFYFDRHPGFFLSLLHFYRT
GRLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRVARPRAWDEDSDTPSSVDPC
TDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLASIAAMCIH
SLPEYQAHEAAAAVATVVAGRGAEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSARNF
FCHPLNLIDIVSVLPFYLTLLAGVALGGNQNGTGGEELGHFGKVVQVFRLMRIFRVLKLA
RHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDEGFATIPACWWWGT
VSMTTVGYGDVVPVTLAGKLAASGCILGGILVVALPITIIFNKFSHFYQRQKALEAAVRN
SGHREFEDLLSSIDGVSEASLGTSRETSQEGRSADLEAPSQSPKPQVY
Download sequence
Identical sequences A4K2Q6
ENSOGAP00000018307 ENSOGAP00000018307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]