SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018468 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018468
Domain Number 1 Region: 213-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-57
Family Voltage-gated potassium channels 0.00046
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 6.8e-25
Family Tetramerization domain of potassium channels 0.00000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018468   Gene: ENSOGAG00000026968   Transcript: ENSOGAT00000024071
Sequence length 511
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:986823:988687:1 gene:ENSOGAG00000026968 transcript:ENSOGAT00000024071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYTTDFDPTSPKGRPGSSPFSNWRSLISDTTNHE
TSFSKLPGDCVDPPGPEPVVWNEGNQRVIINIAGLRFETQLRTLNQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARGVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPSLNSSKTVLSQTMFTDPFFMVESTCIMWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFAALITELVQETEPSTQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKRNIPGEI
DKILNSVGSRTGSTDSLTKTNGGCSTEKSRK
Download sequence
Identical sequences H0XQS6
XP_003784087.1.62490 ENSOGAP00000018468 ENSOGAP00000018468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]