SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018474 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018474
Domain Number 1 Region: 34-380
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000097
Further Details:      
 
Domain Number 2 Region: 388-516
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.95e-29
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018474   Gene: ENSOGAG00000029571   Transcript: ENSOGAT00000026886
Sequence length 518
Comment pep:known_by_projection scaffold:OtoGar3:GL873737.1:1837833:1888077:-1 gene:ENSOGAG00000029571 transcript:ENSOGAT00000026886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALRGPGARFRWRQLASAGGARGAARGAAGQWDYDLLVIGGGSGGLACAKEAAQLGRK
VAVVDYVEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGGMIQDARHYGWEVAQPISHN
WRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVNEHTVCGITKDGKETLLSADNI
VIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDT
TVMMRSIPLRGFDQQMSALVTEHMMSHGTRFLRGRTATRVRRLPAGRLQVTWEDCVSGRE
DTDTFDTILWAIGRVPETKSLNLEKSGVKTSPISQKILVDSQDATSVPHIYAIGDVAEGR
PELTPTAIMAGKFLAQRIFGQSLTLMDYDSVPTTVFTPLEYGCMGLSEEEAVARHGQEHV
EVYHAYYKPLEFMVPGRDASQCYIKMVCLREPPQLVLGLHFLGPNAGEVTQGFALGIRCG
ASYAQVMRTVGIHPTCSEEVVRLRISKRSGLDPTVTGC
Download sequence
Identical sequences H0XQT2
ENSOGAP00000018474 ENSOGAP00000018474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]