SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018556 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018556
Domain Number 1 Region: 36-161
Classification Level Classification E-value
Superfamily Lysozyme-like 4.44e-48
Family C-type lysozyme 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018556   Gene: ENSOGAG00000025382   Transcript: ENSOGAT00000024279
Sequence length 163
Comment pep:known_by_projection scaffold:OtoGar3:GL873631.1:4794761:4796573:1 gene:ENSOGAG00000025382 transcript:ENSOGAT00000024279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARKGAPGRQLCPPAVTVLALASLLSCLPASSKAKVYSRCELARVLHDFGLDGYRGYSL
ADWVCLAYFSSGFNTAAVDHEADGSTNNGIFQINSRKWCKNLSPKSSNQCRMYCSDLLNP
NLKDTVICAMKIAQRPEGLGHWEAWRHHCQGKDLSDWVDGCEF
Download sequence
Identical sequences H0XR14
ENSOGAP00000018556 ENSOGAP00000018556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]