SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018609 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018609
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 4.67e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.04e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018609   Gene: ENSOGAG00000012603   Transcript: ENSOGAT00000012605
Sequence length 427
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:10991238:10992521:-1 gene:ENSOGAG00000012603 transcript:ENSOGAT00000012605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASRESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDESENGVPDSTSTDTPPDLDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences H0XR67
ENSOGAP00000018609 XP_012658452.1.62490 XP_012658453.1.62490 ENSOGAP00000018609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]