SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018687 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018687
Domain Number 1 Region: 653-762
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000041
Further Details:      
 
Domain Number 2 Region: 211-316
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 518-627
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 102-207
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 5 Region: 760-865
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 6 Region: 416-523
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1-107
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018687   Gene: ENSOGAG00000031055   Transcript: ENSOGAT00000030555
Sequence length 867
Comment pep:novel scaffold:OtoGar3:GL874018.1:2888:33877:-1 gene:ENSOGAG00000031055 transcript:ENSOGAT00000030555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLAGGDGPCSGQVEVNSEGDWIPVSDGNFTFPTAQVICAELGCGRAESVLGNVSFREAS
RQVWAEEFQCDGKESGLWFCPRVSCPGGTCHHTGAVQIVCSEYTEVRLMKNGISQCEGQV
EMNISGHWRPLCASHWSMANANVVCHQLGCGVALSTPQGEFFVEGGDEIWKDQFYCSGAE
SSLGHCPVTTLVGSDCNHGNTASVICSVYKSEQIRLVDGGSRCAGRVEIYHEGSWGTICD
DDWDLSDANVVCRQLGCGEALEALGSAQYEVGSGPIWLDKLQCTGKESHVWKCPFQGWSI
HSCDHSEDAGVTCSVHNRWHLCLKGVGCWPHILEVAGSKPPAKNCKKKKKKDNNNTHTHT
HKPITNKQTKKEDPLIFVGFCVVSPSSFFDQSNVQLEGTIIRHSSECSQASRVHRFVRLV
GGLGPCSGRVEVNSGGGWTPVSNGNFMFPTAQVICAELGCGKPASVLEDVSFIKASGQLW
AEEFQCQGQESSLWLCPRAPCAEGTCLHSGAVQIICSEYTEVRLMKNGTSQCEGQVELNI
FGDWRPLCASHWNMANANVVCRQFGCGVAMSTPQGAYIVEEETRILKDQFHCLGTEPFLW
HCPVTALGAPDCNHGNTASVICSGNQTQLLPQCNDSVSDSAGSVTSEESAANCSESHRLR
LVDGGSRCAGRVEIYYKDSWGTICDDNWDLSDAHVVCRQLGCGEALGALGSAQFGEGSGP
IWLDDVNCTGKETHVWRCPSRGWGQHNCRHKEDAGVTCSEFMALRMVSGDQQCAGWLEVF
YNGTWGSVCRSPMEATTVSTICRQLGCGDSGTLNSSVAVREGSRPRWVDVIQCRKTATSL
WQCPSHPWNNRSCSSSDEAYIICAGDL
Download sequence
Identical sequences H0XRE5
ENSOGAP00000018687 ENSOGAP00000018687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]