SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018713 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000018713
Domain Number - Region: 14-46
Classification Level Classification E-value
Superfamily SRCR-like 0.0314
Family Scavenger receptor cysteine-rich (SRCR) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018713   Gene: ENSOGAG00000032304   Transcript: ENSOGAT00000032429
Sequence length 61
Comment pep:known_by_projection scaffold:OtoGar3:GL873770.1:307039:308318:1 gene:ENSOGAG00000032304 transcript:ENSOGAT00000032429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLFLFLAILLATEPVVSECWMDGHCRLVCNDDEDSVIRCRNRKRCCVPSRYLTIQPVR
V
Download sequence
Identical sequences H0XRH1
ENSOGAP00000018713 ENSOGAP00000018713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]