SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018718 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018718
Domain Number 1 Region: 92-135
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000353
Family Hairy Orange domain 0.0058
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000567
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018718   Gene: ENSOGAG00000027480   Transcript: ENSOGAT00000026533
Sequence length 226
Comment pep:known_by_projection scaffold:OtoGar3:GL873652.1:2716958:2718054:-1 gene:ENSOGAG00000027480 transcript:ENSOGAT00000026533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLASGRDRAGSEDEDRWETRRNRKARKPLVEKKRRARINESLQELRLLLAGAEEQVQ
AKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCHAID
ATVAAELLNHLLESMPLREGSSFRDLLGDALAGPPGAPGRSGWPAGGTPGSPMPSPPGSG
DELCSDPEEAPEAELSRAAAEGPDLVPAALGSLTASRIAQSVWRPW
Download sequence
Identical sequences H0XRH6
ENSOGAP00000018718 ENSOGAP00000018718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]