SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018827 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018827
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.1e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018827   Gene: ENSOGAG00000009225   Transcript: ENSOGAT00000009227
Sequence length 108
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:9670589:9670915:1 gene:ENSOGAG00000009225 transcript:ENSOGAT00000009227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILELFPQGPHLLSLEGRTLLEDYQVPSPGPSHHIP
Download sequence
Identical sequences H0XRT5
ENSOGAP00000018827 XP_003785250.1.62490 ENSOGAP00000018827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]