SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018907 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018907
Domain Number 1 Region: 45-131
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000087
Family Extracellular domain of cell surface receptors 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018907   Gene: ENSOGAG00000024875   Transcript: ENSOGAT00000027758
Sequence length 164
Comment pep:known_by_projection scaffold:OtoGar3:GL873599.1:779155:810712:-1 gene:ENSOGAG00000024875 transcript:ENSOGAT00000027758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPRAAPAAPLGGGRRPRGSGRMWVLGITATFCGLFLLPGFALQIQCYQCEEFQLNNDC
SSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVC
ISCCNTPLCNGPRPKKRGSSASVLRPGLSTTVLLLKLALFLAHC
Download sequence
Identical sequences H0XS15
ENSOGAP00000018907 ENSOGAP00000018907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]