SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018908 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018908
Domain Number 1 Region: 192-388
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000451
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018908   Gene: ENSOGAG00000025672   Transcript: ENSOGAT00000027065
Sequence length 391
Comment pep:novel scaffold:OtoGar3:GL873820.1:501117:502639:-1 gene:ENSOGAG00000025672 transcript:ENSOGAT00000027065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDKPVDKPTSLLKLAGQSLLRDEALATAALEELPRELFPPLFTTAFFGRLSETLKAKVRA
SSFPCLPLGVLMKEQQPHQKTFWAVLDRLLAQELPPRRWKLQVLDLRSILWTVWCGTRAS
VCSLLDAEAAQPMRKKQKMEPLAPVEVLIDLALGEGTQDQLLTYLIEKVKQRKGLLQLCC
RKLEIFAMPIHNIKMILNLVQLDSIKDLEVNCTWKLSTLGKFSPHLGQMSNLQRLLLSHV
HMSSSMSLEEEEQNVAQFTSQFLKLHHLQLYLDSVTFFKGHLHQVLTFLKSPLETLSVSN
CLLSEPDFTCLSQCPNISQLKDLCLRGVYLTNISPEPFQVLLEDLDLDECGIMDSSSSSF
LSWACSQLMTFSFWGNPISMAILENVLDTTI
Download sequence
Identical sequences H0XS16
ENSOGAP00000018908 ENSOGAP00000018908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]