SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018930 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018930
Domain Number 1 Region: 162-366
Classification Level Classification E-value
Superfamily RNI-like 5.69e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.000000185
Further Details:      
 
Domain Number 2 Region: 88-144
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000288
Family F-box domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018930   Gene: ENSOGAG00000027880   Transcript: ENSOGAT00000024472
Sequence length 410
Comment pep:novel scaffold:OtoGar3:GL873549.1:8691232:8693481:-1 gene:ENSOGAG00000027880 transcript:ENSOGAT00000024472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETAQQKINFQYCQVKANFSWEGWDSSKTSKLLSGTRVSALEKEEEDSENILQELFSKLSN
PQSSPWKQLKSKGSDEDFVVHRLKLNGENLPGVSWDSLLDEQLLGVFSCLGLPELLKISS
VCKRWYRLGFDESLWQTLNLAGKNLNPDVIGWLLSQGVIAFHCRSFVDQPSVEHSRPFPL
GHLGLSNSVMDVSILRHLSQCSKLQNLSLEGLWLSNPIVNHLSQNSILIRLNFSGCSGFP
ERTLKTLLSGLEELNLSGCYDFTEKHVQAAAPHCETITQLNLSSYRKNLQKVRRCPKLVH
LDLSDSVMLKNDCFQEFYQLNYLQHLSLSRCDIIPETLLELGEIPTLKTLQNTFGIMPDG
TLQLLREALPHLQINCSHLTTIARPTAGNKKNQKIAGIKCRLTLQKPSCL
Download sequence
Identical sequences H0XS38
ENSOGAP00000018930 ENSOGAP00000018930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]