SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018952 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018952
Domain Number 1 Region: 149-250
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 7.32e-29
Family E2F dimerization segment 0.00000212
Further Details:      
 
Domain Number 2 Region: 74-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.89e-17
Family Cell cycle transcription factor e2f-dp 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018952   Gene: ENSOGAG00000024304   Transcript: ENSOGAT00000028650
Sequence length 385
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:15649070:15654585:-1 gene:ENSOGAG00000024304 transcript:ENSOGAT00000028650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSVCMIWPIFKGRRSLLLPHSWLLGILLLFLPQVKRRLDLETDHQYLAESSGPVRGRGR
HPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNV
LEGIQLITKKSKNHIQWLGNHATVGIGGRLEGLTQDLQQLQESEQQLDHLMHICTTQLRL
LSEDSDSQRSTLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAIDSSETFQISLKSKQG
PIDVFLCPEESTGGISPENTSSQGAASGEEDRAADPATTVPPPSSPSSSPTTDPGQSLLS
LEQEPLLSRMGGLRVPVDEDRLSPLVAADSLLEHVREDFSTILPEEFISLSPPHETLDYH
FGLEEGEGIRDLFDCDFGDLTPLDF
Download sequence
Identical sequences H0XS60
ENSOGAP00000018952 ENSOGAP00000018952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]