SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018999 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018999
Domain Number 1 Region: 11-116
Classification Level Classification E-value
Superfamily Prefoldin 2.62e-21
Family Prefoldin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018999   Gene: ENSOGAG00000034295   Transcript: ENSOGAT00000026656
Sequence length 118
Comment pep:novel scaffold:OtoGar3:GL873546.1:19926706:19927062:1 gene:ENSOGAG00000034295 transcript:ENSOGAT00000026656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEILTLVDETNM
YEGAGRMFILPSKEVIHNQLLEKQRIAEEKIKELEQKKSYLERSVKEAEDNIWERLKA
Download sequence
Identical sequences H0XSA7
ENSOGAP00000018999 ENSOGAP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]