SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019010 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019010
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 2 Region: 43-149
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 416-530
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 185-283
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019010   Gene: ENSOGAG00000034152   Transcript: ENSOGAT00000029858
Sequence length 753
Comment pep:known_by_projection scaffold:OtoGar3:GL873587.1:1535939:1557878:1 gene:ENSOGAG00000034152 transcript:ENSOGAT00000029858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPVSVWQCSRWGLQLCLLCSLCLGSPSPSTGPEKRAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCTGAEKS
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFTDSNVIEVEHNLQVEEVRLRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHS
FGLHGVACMGTEAHLSLCSLEFYRANDTTRCPGGAPAVVSCVPGPLYVASSGQKKQQQLK
PQGEAHVRLKGGAHHGEGRVEVLKAGTWGTVCDRKWDLQAASVVCRELGFGSAREALSGA
RMGQGMGAIHVSEVRCSGQEPSLWKCPHRNITADDCSHSQDAAVRCNLPYIGVEAKIRLS
GGRSRHEGRVEVQVGGPGSLRWGLICGDDWGTLEAMVVCRQLGLGYANHGLQETWYWDSG
NITEVVMSGVHCTGNELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQIV
Download sequence
Identical sequences H0XSB8
ENSOGAP00000019010 ENSOGAP00000019010 XP_003793411.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]