SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019043 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019043
Domain Number 1 Region: 392-493
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000019043
Domain Number - Region: 89-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019043   Gene: ENSOGAG00000031847   Transcript: ENSOGAT00000031854
Sequence length 495
Comment pep:known_by_projection scaffold:OtoGar3:GL873593.1:2785467:2860499:1 gene:ENSOGAG00000031847 transcript:ENSOGAT00000031854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKNRTMYLHTVSDRDTGSIFEEPFDGRSLSKLNLCEDGPGHKRRAGGCCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRHVNRLNESFRDLQLRLPQAPLQAD
LSEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDA
AQLELYQLQVESNGSRLLLRRHAGLLDGLARRVGVLGEELADVGGALRGLNHSLSYDVAL
HRARLQDLGVLVSNASEDARRMRRAHLDMELQLKQELAMLNVVTEDLRLKDWEHSIALRN
ISLAKGPPGPKGDQGDEGKEGKAGIPGLPGLRGLPGERGTPGLPGPKGDEGKLGATGPMG
MRGFKGERGPKGEKGEKGDRAGDASVLEAPVVIRLVNGSGPHEGRVEVFHDRRWGTVCDD
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEDTIFRCSFSKWGVT
NCGHAEDAGVTCNRY
Download sequence
Identical sequences H0XSF1
ENSOGAP00000019043 ENSOGAP00000019043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]