SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019074 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019074
Domain Number 1 Region: 425-621
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-48
Family cAMP-binding domain 0.000071
Further Details:      
 
Domain Number 2 Region: 179-424
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-35
Family Voltage-gated potassium channels 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000019074
Domain Number - Region: 641-679
Classification Level Classification E-value
Superfamily t-snare proteins 0.0916
Family t-snare proteins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019074   Gene: ENSOGAG00000028766   Transcript: ENSOGAT00000025226
Sequence length 705
Comment pep:known_by_projection scaffold:OtoGar3:GL873598.1:9002575:9024455:-1 gene:ENSOGAG00000028766 transcript:ENSOGAT00000025226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKINTQYSHPSHLARLAVETSDRDLDHAENGLSRAHSPLEETSAVQQPGITMDARGPSA
SRQSPFASQGLTRLSRLIVSLRTWATRHLHHEDQRPDSFLERFRGAELREVSSRESNMQE
NVGSQEPADRGKSPWPLAKHNTNASNNSEESSDKAKKGDQEKKKEEIKERKKKDAIVVDP
SSNMYYRWLTVIALPIFYNWCLLVCRACFDELQSEHLMLWVALDYSADVLYGLDVLVRAR
TGFLEQGLVVKDPERLWKHYTETLHFKLDVLSLVPTDLAYLKLGLNYPELRFNRLLKFSR
LFEFFDRTETRTNYPNVFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIP
EYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVLDFLVGVLIFATIVGNVGSMI
SNMNASRTEFQAKIDSIKQYMQFRKVTKDLEMRVIRWFDYLWANRKTVDEKEVLKSLPDK
LKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIIK
EGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDD
LMETLTEYPEAKKALEEKGRQILMKDNLIDEELAKDGADPKDLEEKVEHLESSLDTLQTR
FARLLAEYNATQMKVKQRLSQLESQVKICGSSLPSEGEAAKREDK
Download sequence
Identical sequences H0XSI2
ENSOGAP00000019074 ENSOGAP00000019074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]