SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019075 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019075
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019075   Gene: ENSOGAG00000026818   Transcript: ENSOGAT00000030163
Sequence length 322
Comment pep:novel scaffold:OtoGar3:GL873630.1:2856202:2857170:-1 gene:ENSOGAG00000026818 transcript:ENSOGAT00000030163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKSSSGGGFTGATVSSSTPSDCPPELSAELRGAMG
SAGAHSGDKLGSGGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPATTAHPAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSA
SLPGSGLSSVGSIRPPHSLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQVP
PPHHHVSAMGAGSLPRLTSDAK
Download sequence
Identical sequences B4USV3
ENSOGAP00000019075 XP_003797150.2.62490 ENSOGAP00000019075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]